DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and proca

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_956650.1 Gene:proca / 393327 ZFINID:ZDB-GENE-060824-5 Length:434 Species:Danio rerio


Alignment Length:244 Identity:76/244 - (31%)
Similarity:118/244 - (48%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQ-VSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRL-----DDQGYQVR 85
            ::||......:.||| :.|.:.|...|||.:..||.::|||||.  |..::.     |.|.::..
Zfish   195 VMGGNVGKRGESPWQALILNHLGRFHCGGVLIDENWVLTAAHCL--ETSSKFSVRLGDYQRFKFE 257

  Fly    86 AGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP-----IPLAKTNPYP 145
             ||.:|      :.|...|.|.:|......||||::||..|::|::.:.|     :.|||...:.
Zfish   258 -GSEVT------LPVKQHISHPQYNPITVDNDIALLRLDGPVKFSTYILPACLPSLELAKRMLHR 315

  Fly   146 R-SIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC------RLFDPSLLCAGTYG--RTA 201
            . ::.:::|||.:   |.|...|.:.|..:.|.|.....|      .|.| ::||||..|  :.|
Zfish   316 NGTVTIITGWGKN---NQSATSYNSTLHYVELPIVDNKECSRHMMNNLSD-NMLCAGVLGQVKDA 376

  Fly   202 CHGDSGGPLVV----NKQLVGVVSWGRKGCVSS---AFFVSVPYFREWI 243
            |.||||||::.    ...|||:|||| :||...   ..:..|..:.:||
Zfish   377 CEGDSGGPMMTLFHDTWFLVGLVSWG-EGCGQRDKLGIYTKVASYLDWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/242 (31%)
Tryp_SPc 27..243 CDD:238113 74/242 (31%)
procaNP_956650.1 GLA 23..84 CDD:214503
EGF_CA 85..119 CDD:238011
FXa_inhibition 128..165 CDD:291342
Tryp_SPc 195..427 CDD:238113 76/244 (31%)
Tryp_SPc 197..424 CDD:214473 74/240 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.