DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and TMPRSS11F

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_997290.2 Gene:TMPRSS11F / 389208 HGNCID:29994 Length:438 Species:Homo sapiens


Alignment Length:239 Identity:82/239 - (34%)
Similarity:127/239 - (53%) Gaps:30/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QRIIGGEPIGIE-QVPWQVSLQYFGD-HVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87
            |||:.|....:| :.|||.|||..|. |.||.|:.|...::||||||:..:    |...:....|
Human   204 QRIVQGRETAMEGEWPWQASLQLIGSGHQCGASLISNTWLLTAAHCFWKNK----DPTQWIATFG 264

  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTN---PYPRSIA 149
            :.:|.. ....:|..:|:||.|..:.|.||||:|:|||.:||::.||.:.|..::   | |::..
Human   265 ATITPP-AVKRNVRKIILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLP-PKTSV 327

  Fly   150 LVSGWGVSYILND---STNLYPTHLQGLALHI---KSIFSCRLFDPSLLCAG-TYGR-TACHGDS 206
            .|:|:|  .|::|   ...|....::.::..:   |.::. .|..|.:|||| ..|: .||.|||
Human   328 FVTGFG--SIVDDGPIQNTLRQARVETISTDVCNRKDVYD-GLITPGMLCAGFMEGKIDACKGDS 389

  Fly   207 GGPLVVNKQ----LVGVVSWGRKGCV---SSAFFVSVPYFREWI 243
            |||||.:..    :||:|||| :.|.   ....:..|..:|:||
Human   390 GGPLVYDNHDIWYIVGIVSWG-QSCALPKKPGVYTRVTKYRDWI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/236 (33%)
Tryp_SPc 27..243 CDD:238113 78/235 (33%)
TMPRSS11FNP_997290.2 SEA 59..154 CDD:279699
Tryp_SPc 205..432 CDD:214473 79/236 (33%)
Tryp_SPc 206..435 CDD:238113 80/237 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.