DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG16998

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:238 Identity:72/238 - (30%)
Similarity:114/238 - (47%) Gaps:27/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            ::||:||..:.|...||..|:...|::.|..::.:...:|||.||.      :..| .|.|||||
  Fly    22 QERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCV------QYPD-SYSVRAGS 79

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ--PIPLAKTNPYPRSIALV 151
            ..||..|...:|.::|:|.::......||||:::|.........:|  .:||...|..||:: ||
  Fly    80 TFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQVVKLPLPSLNILPRTL-LV 143

  Fly   152 SGWGVSYILNDSTNL-YPTHLQGLALHIKSIFSC-RLFD-------PSLLCAGTYGRTACHGDSG 207
            :|||..    |:|:. ....|:|..:.:.:...| ||:.       ..::||...||..|:||||
  Fly   144 AGWGNP----DATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDDMVCAAGAGRDHCYGDSG 204

  Fly   208 GPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAI 247
            .|||......|:||:.. ||....|   :..:..:..||.|.:
  Fly   205 APLVHRGSSYGIVSFAH-GCADPHFPGVYTRLANYVTWIFNVL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 69/230 (30%)
Tryp_SPc 27..243 CDD:238113 68/229 (30%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/230 (30%)
Tryp_SPc 25..242 CDD:238113 68/229 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.