DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG32271

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:249 Identity:76/249 - (30%)
Similarity:118/249 - (47%) Gaps:18/249 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            |.|:.|.:.::.:.|   .||:||.|:.|..||:.|:|:..|:.:||||:.:...:||||||...
  Fly     8 LHLIPLCWAASNEAN---SRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCVKG 69

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI 136
            ...:|:     .|.||.......|....|..:...:.|......:|:|:::|..|:. ..||..|
  Fly    70 IGASRI-----LVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTI 128

  Fly   137 PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFS-CRL---FDPSLLCAGTY 197
            .|..|:.....:..|||||.....|.:.::....:....:..|:..| .:|   ...::.||...
  Fly   129 ELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVP 193

  Fly   198 G-RTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAI 247
            | :.||.||||||.|...||.|:|||| .||.   |...:.:|...|.:|..|:
  Fly   194 GVKDACEGDSGGPAVYQGQLCGIVSWG-VGCARKSSPGVYTNVKTVRSFIDKAL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/224 (31%)
Tryp_SPc 27..243 CDD:238113 69/223 (31%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 70/224 (31%)
Tryp_SPc 25..244 CDD:238113 70/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.