DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and KLKB1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:255 Identity:81/255 - (31%)
Similarity:121/255 - (47%) Gaps:48/255 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY---FGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87
            ||:||......:.|||||||.   ...|:||||:.....::||||||   :|..|.|. :::.:|
Human   401 RIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCF---DGLPLQDV-WRIYSG 461

  Fly    88 ----SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAK-------- 140
                |.:| .:.....:..:|||:.|......:|||:::|..||.:|...:||.|..        
Human   462 ILNLSDIT-KDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIY 525

  Fly   141 TNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR------LFDPSLLCAGTY-- 197
            ||.:      |:|||.|....:..|:    ||.:.:.:.:...|:      .....::||| |  
Human   526 TNCW------VTGWGFSKEKGEIQNI----LQKVNIPLVTNEECQKRYQDYKITQRMVCAG-YKE 579

  Fly   198 -GRTACHGDSGGPLVVNK----QLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
             |:.||.||||||||...    :|||:.||| :||.   ....:..|..:.:|||....|
Human   580 GGKDACKGDSGGPLVCKHNGMWRLVGITSWG-EGCARREQPGVYTKVAEYMDWILEKTQS 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/247 (31%)
Tryp_SPc 27..243 CDD:238113 76/246 (31%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 401..632 CDD:214473 77/247 (31%)
Tryp_SPc 402..632 CDD:238113 76/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.