DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG13430

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:277 Identity:96/277 - (34%)
Similarity:134/277 - (48%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALDFLSAGQVNRW-------------EQ--RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYS 58
            :.:|||..|  |..|             ||  ||:||....|...|.|||||....|.|||:|.|
  Fly     1 MTSLDFRLA--VALWLICTSAAQNSTDVEQDGRIVGGWETHITFFPHQVSLQLGTRHACGGTIIS 63

  Fly    59 ENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNI-NDIAIVR 122
            .|||:|||||..:..    ..|.|.:||||:.....|:.:.|..:|.|.|:.....: ||||||:
  Fly    64 PNIILTAAHCVLEYS----KPQYYVIRAGSSDWTKGGSYIRVKKIIPHPEFHDPTRMNNDIAIVQ 124

  Fly   123 LSTPLEFTSKVQPIPLAKTNP--YPRSIALVSGWGVSYILNDSTNLYP--------THLQGLALH 177
            |..||.::..::||.||.:..  .|.:...|||||.:.|    :.:.|        .||:.....
  Fly   125 LQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWGSTSI----SQMQPEKRLRYTVVHLRDQNQC 185

  Fly   178 IKSIFSCRLFDPSLLCAGTY--GRTACHGDSGGPLVVN----KQLVGVVSWGRKGCVSSAF---F 233
            .::.|.......::.||||.  ||.:|.||||||||.:    .:|.|:|||| .||.::.|   :
  Fly   186 ARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLVTSIDGRLKLYGIVSWG-FGCANAMFPGIY 249

  Fly   234 VSVPYFREWILNAIASI 250
            ..|..:.:||...|..:
  Fly   250 TKVSAYDDWIAQTIEEL 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 85/236 (36%)
Tryp_SPc 27..243 CDD:238113 84/235 (36%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 85/236 (36%)
Tryp_SPc 32..262 CDD:238113 86/238 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443257
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.