DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG32270

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:240 Identity:84/240 - (35%)
Similarity:124/240 - (51%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRA 86
            |...||:||.|..:...|..|:::..|:..||||:.:...::|||||..|  ||..|   :.||.
  Fly    26 RRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLND--GNPSD---FVVRG 85

  Fly    87 G-SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL 150
            | :.|:|...:.. |..:::...|:.....:|:|:::|..||: .|..:||.||..:|.|.|...
  Fly    86 GVTYLSDMRNSRY-VRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVR 148

  Fly   151 VSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR-LF------DPSLLCAGTYG-RTACHGDSG 207
            |||||::   :.|:...|..||.:.:.:.....|| |:      ..|:.||...| :.||.||||
  Fly   149 VSGWGLT---DSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSG 210

  Fly   208 GPLV-VNKQLVGVVSWGR-KGCV---SSAFFVSVPYFREWILNAI 247
            ||:| .|..||||||||| ..|.   |...:..|.|..:||.:.|
  Fly   211 GPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/230 (35%)
Tryp_SPc 27..243 CDD:238113 79/229 (34%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/230 (35%)
Tryp_SPc 31..254 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.