DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG9897

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:73/272 - (26%)
Similarity:122/272 - (44%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            |.::||.:|:.|     :||||.|..:.|:..||..|:.......|||:|.|:|.|:|||.|.  
  Fly     8 LQIVALPWLALG-----DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCV-- 65

  Fly    72 EEGNRLDDQGY-----QVRAGSALTDSNGTLVDVAALIIHEEYA---FDLNINDIAIVRLSTPLE 128
                    .||     |||.|::...::|::..:..:.:|.:|:   ||   |::|:::....|.
  Fly    66 --------DGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFD---NNLALLKTCELLN 119

  Fly   129 FTSKVQPIPLAKTNPYPRSIALVSGWG--------------VSYILNDSTNLYPTHLQGLALHIK 179
            .|.:::||..|...|...|.|.|:|.|              :|..:.:.....|..|.|..:.|.
  Fly   120 TTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRIL 184

  Fly   180 SIFSC------------RLFDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGC-VSSA 231
            |...|            :......:|..:.|:.||..|.|.|||::.:|||::|  |.|| :...
  Fly   185 SQKQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILS--RAGCSIKPD 247

  Fly   232 FFVSVPYFREWI 243
            .:.::.....|:
  Fly   248 VYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 66/251 (26%)
Tryp_SPc 27..243 CDD:238113 65/250 (26%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.