DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG32833

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:277 Identity:80/277 - (28%)
Similarity:128/277 - (46%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLS-----AGQ------VNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGG 54
            |.:.|..:.|||..||     ||:      .|...:..:||.|:.|...||..|:.......|.|
  Fly     1 MLLRSLPIFLALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWIASISIKQKAKCDG 65

  Fly    55 SIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTL-VDVAALIIHEEYAFDLNINDI 118
            :||..:.||||..| .|...|::    .:||.||. |.|:|.: |.|..:.:||::......:::
  Fly    66 AIYKLSHIVTAGKC-VDGFLNKV----IRVRVGST-TRSDGVIEVAVCNITVHEKFTGQTVFHNV 124

  Fly   119 AIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSG-------WGVSY---ILNDSTN-------- 165
            ||::|..|||.:..:|||.||  |..|.:.|.|:.       |...|   .|:|...        
  Fly   125 AILKLCEPLEASKTIQPIQLA--NQLPSNGAKVTANGWPSFRWWAMYWKKCLDDEAYKLQKAEVK 187

  Fly   166 -LYPTHLQGLALHIKSIFSCRLFDPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVS 229
             |.|:  |...|..::.:|.:.|...|.|...:.:.||....|.|:|.|.:|||:::.|  ||..
  Fly   188 LLGPS--QCTDLWARNNWSKKNFTDDLFCTEKFAKEACSLAMGSPVVHNGKLVGIITKG--GCSE 248

  Fly   230 -SAFFVSVPYFREWILN 245
             ...::::..:::|:.|
  Fly   249 YPEVYINLIKYKDWLHN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/237 (29%)
Tryp_SPc 27..243 CDD:238113 68/236 (29%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 70/238 (29%)
Tryp_SPc 40..262 CDD:214473 68/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.