DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG11192

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:265 Identity:90/265 - (33%)
Similarity:134/265 - (50%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFL-LLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVT 64
            |:...|| .|:||...:.......:.||:|||...|::.|:|||:|..|.|:|||:|...:.::|
  Fly     1 MYSTKFLWWLMALVAYAGATPTPGDGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLT 65

  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129
            |||||.|.    .....|.||.||:..:|.|.::.:..:|.|.:|....:.||:|::.|:..|.|
  Fly    66 AAHCFEDP----WSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHDNDLALLILNGQLNF 126

  Fly   130 TSKVQPIPLAK-TNPYPRSIAL-VSGWGV---SYILNDSTNLYPTHLQGLALHIKSIFSCRL--- 186
            |..:||:|||. .:|......| |||||.   ...::....:.| .|:.:.:.:.....||.   
  Fly   127 TEHLQPVPLAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSP-QLRFVDVDLVESNQCRRAYS 190

  Fly   187 ----FDPSLLCAGTYGRTACHGDSGGPLV------VNKQLVGVVSWGRKGCVSSAF---FVSVPY 238
                ....::||...||.:|.||||||||      ...:|.|:|||| .||.:..|   :.:|..
  Fly   191 QVLPITRRMICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWG-LGCANPNFPGVYTNVAA 254

  Fly   239 FREWI 243
            ||.||
  Fly   255 FRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 82/237 (35%)
Tryp_SPc 27..243 CDD:238113 81/236 (34%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 82/237 (35%)
Tryp_SPc 28..262 CDD:238113 83/238 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443273
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6460
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.