DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss48

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:284 Identity:89/284 - (31%)
Similarity:141/284 - (49%) Gaps:54/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQ--------------RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIY 57
            |.:|.|.||.|.|.:..::              ||:||:...:.:.||||||::...|.||||:.
Mouse     6 LKVLLLLFLGAFQGSFTKKKNLQSVCGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLI 70

  Fly    58 SENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTD--SNGTLVDVAALIIHEEYAFDLNINDIAI 120
            |::.::|||||......:.|    |.|..||...:  |.|....|:.:.|.:::..  ...|||:
Mouse    71 SDHWVLTAAHCIKKTWYSFL----YSVWLGSIDREYSSTGKEYYVSRIAIPDKHRH--TEADIAL 129

  Fly   121 VRLSTPLEFTSKVQPIPL---AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIF 182
            ::||:.:.|:|.:.||.|   :|....|.| ..|:|||     .:....||:.||.|.:.:.|..
Mouse   130 LKLSSRVTFSSVILPICLPNISKQLTVPAS-CWVTGWG-----QNQEGHYPSTLQELEVPVISSE 188

  Fly   183 SC-RLFDP--------------SLLCAG--TYGRTACHGDSGGPLVVN----KQLVGVVSWGRK- 225
            :| :|::|              .:.|||  ...:.:|.|||||||..:    .:|:||||||.: 
Mouse   189 ACEQLYNPIGVFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLEC 253

  Fly   226 GCVSSAFFVSVPYFREWILNAIAS 249
            |......:.:|.|:::|| :||.|
Mouse   254 GKDLPGVYTNVTYYQKWI-SAIIS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/243 (32%)
Tryp_SPc 27..243 CDD:238113 76/242 (31%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 77/243 (32%)
Tryp_SPc 40..274 CDD:238113 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.