DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss3

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:254 Identity:82/254 - (32%)
Similarity:128/254 - (50%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            ||.|||..::.......:.:|:||.......||:||||. .|.|.||||:.::..:|:||||:..
  Rat     4 LLFLALVGVAVAFPVDDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHCYKT 67

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQP 135
            ....||.:....|..|      :...|:.|.:|.|..: |.:|| |||.:::||:|::..::|..
  Rat    68 RIQVRLGEHNINVLEG------DEQFVNAAKIIKHPNFNARNLN-NDIMLIKLSSPVKLNARVAT 125

  Fly   136 IPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP-----SLLCAG 195
            :.|..:.....:..|:||||.:..|..:.   |..||.|...:.....|....|     :::|.|
  Rat   126 VALPSSCAPAGTQCLISGWGNTLSLGVNN---PDLLQCLDAPVLPQADCEASYPGKITNNMICVG 187

  Fly   196 TY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIAS 249
            ..  |:.:|.||||||:|.|.||.|:|||| .||.   :...:..|..:.:||.:.||:
  Rat   188 FLEGGKDSCQGDSGGPVVCNGQLQGIVSWG-YGCALKDNPGVYTKVCNYVDWIQDTIAA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/227 (32%)
Tryp_SPc 27..243 CDD:238113 73/226 (32%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 73/227 (32%)
Tryp_SPc 24..242 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.