DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS41

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:273 Identity:82/273 - (30%)
Similarity:126/273 - (46%) Gaps:62/273 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DFLSAGQVNRWEQRIIGGEPIGIEQV----PWQVSLQYFGDHVCGGSIYSENIIVTAAHCF---- 69
            :.||....:|....::.|   |:|..    |||.||:....|.||||:.|...:::|||||    
Human    56 ELLSEACGHREIHALVAG---GVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHY 117

  Fly    70 FDEEGNRLDDQGYQVRAGSALTD--------SNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTP 126
            :..|        :.|:.|. ||.        :..:...|..:|::.: |..:..||||::||::.
Human   118 YPSE--------WTVQLGE-LTSRPTPWNLRAYSSRYKVQDIIVNPD-ALGVLRNDIALLRLASS 172

  Fly   127 LEFTSKVQPIPLAKT--NPYPRSIALVSGWGVSYILNDSTNLYPTH-LQGLALHIKSIFSCR-LF 187
            :.:.:.:|||.:..:  |...|....|:|||:  |....|.|.|.: |:...:.|.:...|. ||
Human   173 VTYNAYIQPICIESSTFNFVHRPDCWVTGWGL--ISPSGTPLPPPYNLREAQVTILNNTRCNYLF 235

  Fly   188 D---------PSLLCAGTYGRT--ACHGDSGGPLVVNKQ----LVGVVSWG-------RKGCVSS 230
            :         .|:.|||....:  .|.||||||||.:|.    .||:||||       |.|..::
Human   236 EQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTN 300

  Fly   231 AFFVSVPYFREWI 243
               :|| || .||
Human   301 ---ISV-YF-HWI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/258 (30%)
Tryp_SPc 27..243 CDD:238113 77/257 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.