DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG8172

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster


Alignment Length:268 Identity:78/268 - (29%)
Similarity:117/268 - (43%) Gaps:52/268 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GQVNRWEQRIIGGEPIGIEQVPWQVSLQYFG----DHVCGGSIYSENIIVTAAHCFFDEEGNRLD 78
            |:|.....||:||...|....||||:|...|    ...|||::.|...::|||||......:.: 
  Fly   307 GEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSNM- 370

  Fly    79 DQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLN-----------INDIAIVRLSTPLEFTSK 132
                ::|.|.  .|..|.    ...:.||||..:..           :||:|::||...:.:...
  Fly   371 ----KIRLGE--WDVRGQ----EERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQH 425

  Fly   133 VQPIPL-AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-RLFDPS----- 190
            :.|:.| ..|......:|.|:|||.:   ....:..|:.||.:.:.:.|...| |.|..:     
  Fly   426 IIPVCLPPSTTKLTGKMATVAGWGRT---RHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREA 487

  Fly   191 ----LLCAGTY---GRTACHGDSGGPLVV----NKQLVGVVSWGRKGCVSS---AFFVSVPYFRE 241
                .|||| |   ||.:|.|||||||.:    .|.|:|:|||| .||...   ..:.::..|..
  Fly   488 IHDVFLCAG-YKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWG-IGCGREHLPGVYTNIQRFVP 550

  Fly   242 WILNAIAS 249
            ||...:|:
  Fly   551 WINKVMAN 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/252 (29%)
Tryp_SPc 27..243 CDD:238113 72/251 (29%)
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 73/252 (29%)
Tryp_SPc 316..555 CDD:238113 74/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.