DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and KLK3

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001639.1 Gene:KLK3 / 354 HGNCID:6364 Length:261 Species:Homo sapiens


Alignment Length:279 Identity:79/279 - (28%)
Similarity:119/279 - (42%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65
            |::....|.|::.::.|..:..  .||:||........||||.:...|..||||.:.....::||
Human     1 MWVPVVFLTLSVTWIGAAPLIL--SRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTA 63

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSAL---------TDSNGTLVDVAALIIHEEYAFDL-------- 113
            |||               :|..|.:         .:..|.:..|:....|..|...|        
Human    64 AHC---------------IRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRP 113

  Fly   114 ---NINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLA 175
               :.:|:.::|||.|.|.|..|:.:.|....|...:....||||   .:.....|.|..||.:.
Human   114 GDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWG---SIEPEEFLTPKKLQCVD 175

  Fly   176 LHIKSIFSCRLFDPS-----LLCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCV---SS 230
            ||:.|...|....|.     :||||  |.|::.|.||||||||.|..|.|:.|||.:.|.   ..
Human   176 LHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP 240

  Fly   231 AFFVSVPYFREWILNAIAS 249
            :.:..|.::|:||.:.|.:
Human   241 SLYTKVVHYRKWIKDTIVA 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 72/246 (29%)
Tryp_SPc 27..243 CDD:238113 71/245 (29%)
KLK3NP_001639.1 Tryp_SPc 25..256 CDD:238113 73/248 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.