DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Send2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:250 Identity:157/250 - (62%)
Similarity:186/250 - (74%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65
            |||:||||||||:.||||.|.|.|:|||||:|||||:.|||||:|..|.|:|||||||.:||:||
  Fly     1 MFIQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITA 65

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT 130
            |||        :..|||||||||||.:|||::|||||:..||...     |||||||||.|||||
  Fly    66 AHC--------VQGQGYQVRAGSALKNSNGSVVDVAAIRTHEGLG-----NDIAIVRLSKPLEFT 117

  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLCAG 195
            ::|||||||||||.|.|||.|||||.|     |...:|..|||:.|:|:..:.|.|.:||.:|||
  Fly   118 NQVQPIPLAKTNPPPGSIAFVSGWGSS-----SYYSHPIDLQGVNLYIQWPYYCGLTEPSRICAG 177

  Fly   196 TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAFFVSVPYFREWILNAIASI 250
            ::||.||.||||||||.::|||||||.|.|.|..|:.:.|||||||||||||..|
  Fly   178 SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDCTYSSIYTSVPYFREWILNAIDEI 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 132/216 (61%)
Tryp_SPc 27..243 CDD:238113 131/215 (61%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 132/216 (61%)
Tryp_SPc 27..225 CDD:238113 131/215 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.