DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and l(2)k05911

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_723797.3 Gene:l(2)k05911 / 34731 FlyBaseID:FBgn0284244 Length:639 Species:Drosophila melanogaster


Alignment Length:254 Identity:82/254 - (32%)
Similarity:122/254 - (48%) Gaps:42/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            ::||:||......:.||...|...|...||||:.:.:.|:|||||.     .|:  ..:.|.|.:
  Fly   397 QERIVGGINASPHEFPWIAVLFKSGKQFCGGSLITNSHILTAAHCV-----ARM--TSWDVAALT 454

  Fly    89 A-LTDSN-GTLVDV-------AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI-----PLA 139
            | |.|.| ||..:|       ..|:.|:.:.|....||:||:.||.|:.||.::|||     |..
  Fly   455 AHLGDYNIGTDFEVQHVSRRIKRLVRHKGFEFSTLHNDVAILTLSEPVPFTREIQPICLPTSPSQ 519

  Fly   140 KTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-RLFD--------PSLLCAG 195
            ::..|...:|.|:|||   .|.:: ...|:.||.:.:.|.:...| |.:.        .|::|||
  Fly   520 QSRSYSGQVATVAGWG---SLREN-GPQPSILQKVDIPIWTNAECARKYGRAAPGGIIESMICAG 580

  Fly   196 TYGRTACHGDSGGPLVVNK----QLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAI 247
            ...:.:|.||||||:|:|.    ..||:|||| .||....:   :..|.....||...|
  Fly   581 QAAKDSCSGDSGGPMVINDGGRYTQVGIVSWG-IGCGKGQYPGVYTRVTSLLPWIYKNI 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/246 (32%)
Tryp_SPc 27..243 CDD:238113 78/245 (32%)
l(2)k05911NP_723797.3 CLIP 111..174 CDD:197829
Tryp_SPc 399..634 CDD:214473 79/246 (32%)
Tryp_SPc 400..637 CDD:238113 80/248 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.