DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Phae1

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:257 Identity:83/257 - (32%)
Similarity:122/257 - (47%) Gaps:29/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            ||||.:..:|...:...|.|::||.|..:...|:.||:||.|.|.|..||.:.|.:||||||.  
  Fly    16 LLLLGICRISGVAIGAPEGRVVGGSPAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAAHCL-- 78

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAAL---IIHEEYAFDLNINDIAIVRLSTPLEFTSKV 133
            ...|::  .|..:.|||...|...:.....::   :|::.|.......||.::...|...:::.|
  Fly    79 TNSNQV--LGSTLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTVPYDIGMIYTPTAFVWSAAV 141

  Fly   134 QPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQ-GLALHIKSIFSCRLFDPSL------ 191
            .|:.|..:...|...|.:.|||.:...|  |..||:.|| ...:.|.|:.||   :.:|      
  Fly   142 APVTLPSSGVVPTGTANLYGWGSTSTTN--TASYPSTLQVATNVPIISLSSC---ESALGTKGSD 201

  Fly   192 -----LCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFREWI 243
                 ||.|  |.|.:.|..|||||||....|:|:||||:..|   .|.:.:|.|..|..||
  Fly   202 VHSTNLCTGPLTGGVSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYVQVSSFISWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 75/236 (32%)
Tryp_SPc 27..243 CDD:238113 74/235 (31%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 75/236 (32%)
Tryp_SPc 36..266 CDD:238113 76/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.