DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS38

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:253 Identity:83/253 - (32%)
Similarity:125/253 - (49%) Gaps:46/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            |.:|:||.|....:.|||||:.|.|.|||||||.:|..:::|||||..::..::.|. |......
Human    57 EGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDKNIKIYDM-YVGLVNL 120

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNI-NDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVS 152
            .:..::....:|..:|:|..|.....| .|:|:|:|.|.:.|:..|.|:.||..     .:.|.|
Human   121 RVAGNHTQWYEVNRVILHPTYEMYHPIGGDVALVQLKTRIVFSESVLPVCLATP-----EVNLTS 180

  Fly   153 ------GWGVSYILNDSTNLYPTHLQGLAL-------------HIKSIFSCRLFDPSLLCAGTY- 197
                  |||:.....::::    .||.:.|             |:..|.      |.:||||.. 
Human   181 ANCWATGWGLVSKQGETSD----ELQEMQLPLILEPWCHLLYGHMSYIM------PDMLCAGDIL 235

  Fly   198 -GRTACHGDSGGPLV--VNKQ--LVGVVSWGRKGCVSSAF---FVSVPYFREWILNAI 247
             .:|.|.||||||||  .|:.  .:|:||||| ||.:..:   :.||.||.:||.:.|
Human   236 NAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGR-GCSNPLYPGVYASVSYFSKWICDNI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 79/245 (32%)
Tryp_SPc 27..243 CDD:238113 79/244 (32%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.