DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and PRSS53

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:252 Identity:63/252 - (25%)
Similarity:94/252 - (37%) Gaps:66/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS---NGTLVDV 100
            |||.|::..|.|:|.||:.::..::||||||  |:....:...:.|..||...:.   ....|.|
Human    49 PWQASVRRQGAHICSGSLVADTWVLTAAHCF--EKAAATELNSWSVVLGSLQREGLSPGAEEVGV 111

  Fly   101 AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWG---------- 155
            |||.:...|......:|:|:::|:.|...|....|.| |...|:..| ...:||.          
Human   112 AALQLPRAYNHYSQGSDLALLQLAHPTTHTPLCLPQP-AHRFPFGAS-CWATGWDQDTSDGKCWP 174

  Fly   156 -----------------------VSYILNDSTNLYPT--------HLQGLALHIKSIFSCRLF-- 187
                                   .|.:|..|..|.|.        .|:.|.|.:.|..:|...  
Human   175 RLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTCNCIYN 239

  Fly   188 -----------DPSLLCAGTYG--RTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSA 231
                       .|.:||.|...  :..|.||||||::.   |.....|.:.|.:|.|
Human   240 QLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLC---LEPDGHWVQAGIISFA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 63/252 (25%)
Tryp_SPc 27..243 CDD:238113 63/252 (25%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 63/252 (25%)
Tryp_SPc 43..314 CDD:214473 63/252 (25%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.