Sequence 1: | NP_722785.1 | Gene: | CG17234 / 59225 | FlyBaseID: | FBgn0042187 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011544118.1 | Gene: | PRSS53 / 339105 | HGNCID: | 34407 | Length: | 623 | Species: | Homo sapiens |
Alignment Length: | 252 | Identity: | 63/252 - (25%) |
---|---|---|---|
Similarity: | 94/252 - (37%) | Gaps: | 66/252 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS---NGTLVDV 100
Fly 101 AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWG---------- 155
Fly 156 -----------------------VSYILNDSTNLYPT--------HLQGLALHIKSIFSCRLF-- 187
Fly 188 -----------DPSLLCAGTYG--RTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSA 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17234 | NP_722785.1 | Tryp_SPc | 26..243 | CDD:214473 | 63/252 (25%) |
Tryp_SPc | 27..243 | CDD:238113 | 63/252 (25%) | ||
PRSS53 | XP_011544118.1 | Tryp_SPc | 42..316 | CDD:238113 | 63/252 (25%) |
Tryp_SPc | 43..314 | CDD:214473 | 63/252 (25%) | ||
Tryp_SPc | 359..>512 | CDD:304450 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165149434 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |