DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG4271

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:216 Identity:69/216 - (31%)
Similarity:105/216 - (48%) Gaps:44/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYA-F 111
            |.|.|||::....|::|||.|..::...|:     .||.|:......|.::.|.||::||.|. :
  Fly    40 GYHECGGAVIDSRIVLTAAQCVKNKPVKRI-----TVRVGTPDIYRGGRIIRVTALVVHENYKNW 99

  Fly   112 DLNINDIAIVRLSTPLEFTSKVQPIPLAKTNP----YPRSIALVSGWG----VSYIL-----NDS 163
            |   ||||::.|..|: .:.:|..||||...|    ||.:    :|||    .||::     |..
  Fly   100 D---NDIALLWLEKPV-LSVRVTKIPLATKEPSENEYPSN----AGWGEKLLESYVVTRKLQNGV 156

  Fly   164 TNLYPTHLQGLALHIKSIFSCRLFDP---SLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRK 225
            |.:.|          :|:.:..|.:|   .||||.......|.||.|||||:..::||:...|. 
  Fly   157 TKIRP----------RSMCAEELVEPVGEELLCAFYTENDICPGDYGGPLVLANKVVGIAVQGH- 210

  Fly   226 GC---VSSAFFVSVPYFREWI 243
            ||   |..:.:.:|.::.|||
  Fly   211 GCGFAVLPSLYTNVFHYLEWI 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/214 (31%)
Tryp_SPc 27..243 CDD:238113 67/214 (31%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 69/216 (32%)
Tryp_SPc 19..231 CDD:214473 67/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.