DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Ser12

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:266 Identity:101/266 - (37%)
Similarity:144/266 - (54%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTA 65
            |.:...:|:.::..:|||..   .:||:||.|:.|.:||||.:|.|...::||..|||:.||:||
  Fly     1 MLLHWLVLVASVTLISAGSS---PERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITA 62

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEF 129
            |||.     .|..|..|.||.||...:..|....||.:..||:| :..:..||||::||...|.|
  Fly    63 AHCV-----ERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIF 122

  Fly   130 TSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP----- 189
            .::|:||.||.:.|...:.|.|||||...||    .|.||.|      :|:  |.::.||     
  Fly   123 NAEVRPIQLADSAPAAGTEASVSGWGEIGIL----WLQPTSL------LKT--SVKILDPNVCKR 175

  Fly   190 -------SLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWIL 244
                   :::||....:.:||||||||||...||||:||:| .||.:..|   :.:|...:.|||
  Fly   176 SYQYITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYG-IGCANPFFPGVYANVAELKPWIL 239

  Fly   245 NAIASI 250
            |||..:
  Fly   240 NAIEQL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 90/232 (39%)
Tryp_SPc 27..243 CDD:238113 89/231 (39%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 90/232 (39%)
Tryp_SPc 24..238 CDD:238113 89/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443134
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.