DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Ser6

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:253 Identity:100/253 - (39%)
Similarity:133/253 - (52%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SFLLLLALDFLSA-GQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHC 68
            ||||.|.|...|| |::|   .|::|||.....|.|.||||:..|.|.|||||.:...|:|||||
  Fly    12 SFLLFLVLPVQSAPGKLN---GRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTYILTAAHC 73

  Fly    69 FFDEEGNR----LDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129
            ..:|:.|.    :..:.:.:||||....|.|.||.||.:|:||||...|  ||:|::||.:||..
  Fly    74 VSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLIL 136

  Fly   130 TSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIF--SCRL-----F 187
            ::.:|||.|...:.......::||||......|    .|.:||...|  |||.  .|..     |
  Fly   137 SASIQPIDLPTVDTPADVDVVISGWGRIKHQGD----LPRYLQYNTL--KSITRQQCEELIDFGF 195

  Fly   188 DPSLLCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS--AFFVSVPYFREWI 243
            :..|.........||:||||||.|.|.|||||..:...||.|:  ..:..|.||::||
  Fly   196 EGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 88/229 (38%)
Tryp_SPc 27..243 CDD:238113 87/228 (38%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 88/229 (38%)
Tryp_SPc 32..256 CDD:238113 89/230 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.