Sequence 1: | NP_722785.1 | Gene: | CG17234 / 59225 | FlyBaseID: | FBgn0042187 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074737.1 | Gene: | Prss53 / 330657 | MGIID: | 2652890 | Length: | 552 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 59/211 - (27%) |
---|---|---|---|
Similarity: | 97/211 - (45%) | Gaps: | 35/211 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS---NGTLVDV 100
Fly 101 AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-VSGWGVSYILNDST 164
Fly 165 NLYPTHLQGLALHIKSIFSC---------RLFD----PSLLCAGTY--GRTACHGDSGGPLVVNK 214
Fly 215 Q-----LVGVVSWGRK 225 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17234 | NP_722785.1 | Tryp_SPc | 26..243 | CDD:214473 | 59/211 (28%) |
Tryp_SPc | 27..243 | CDD:238113 | 59/211 (28%) | ||
Prss53 | NP_001074737.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 27..46 | ||
Tryp_SPc | 45..271 | CDD:238113 | 59/211 (28%) | ||
Tryp_SPc | 311..522 | CDD:238113 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167839493 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24276 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |