DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss53

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:211 Identity:59/211 - (27%)
Similarity:97/211 - (45%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDS---NGTLVDV 100
            |||.|::..|.|:|.||:.::..::||||||  |:....:...:.|..||...:.   ....|.|
Mouse    49 PWQASVRRQGVHICSGSLVADTWVLTAAHCF--EKMATAELSSWSVVLGSLKQEGQSPGAEEVGV 111

  Fly   101 AALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIAL-VSGWGVSYILNDST 164
            |||.:.:.|......:|:|:::|:.|...|:...|.|   |..:|...:. .:||      :.:|
Mouse   112 AALQLPKAYNHYSQGSDLALLQLTHPTVQTTLCLPQP---TYHFPFGASCWATGW------DQNT 167

  Fly   165 NLYPTHLQGLALHIKSIFSC---------RLFD----PSLLCAGTY--GRTACHGDSGGPLVVNK 214
            :.....|:.|.|.:.|..:|         ||..    |.:||.|..  .:..|.||||||::..:
Mouse   168 SDVSRTLRNLRLRLISRPTCNCLYNRLHQRLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCRE 232

  Fly   215 Q-----LVGVVSWGRK 225
            .     .||::|:..|
Mouse   233 PDGHWVQVGIISFTSK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 59/211 (28%)
Tryp_SPc 27..243 CDD:238113 59/211 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46
Tryp_SPc 45..271 CDD:238113 59/211 (28%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839493
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.