DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP010243

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_554157.3 Gene:AgaP_AGAP010243 / 3292148 VectorBaseID:AGAP010243 Length:275 Species:Anopheles gambiae


Alignment Length:237 Identity:80/237 - (33%)
Similarity:122/237 - (51%) Gaps:30/237 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDD--QGY-QVRAGS 88
            |:||..:.||..|:|||::...:|:|||||.:...::||.||        :||  ..| .||.||
Mosquito    47 IVGGHVVDIEMHPYQVSVRELNEHICGGSIITNRWVLTAGHC--------VDDTIAAYMNVRVGS 103

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLA--KTNPYPRSIALV 151
            |.....||:..|.::..|.::.....:.|.|:::|...:.|::..|||.||  ..|.......:|
Mosquito   104 AFYAKGGTIHPVDSVTTHPDHVPYSWLADFALLQLKHAIVFSTIAQPIALAFRLDNALSDRECVV 168

  Fly   152 SGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL-----FDPSLLCAGTY---GRTACHGDSGG 208
            :|||.:  ||:..:.  ..|:.:.:.:.|...|..     .|.:::|||.:   |:.:|..||||
Mosquito   169 TGWGRT--LNEEESF--DKLRAVQIPLVSRVLCNATYEGKIDQTMICAGDFVDGGKGSCAYDSGG 229

  Fly   209 PLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAI 247
            |||.....||:|||| |||....:   :.||.|.|.|| |:|
Mosquito   230 PLVCGDMQVGIVSWG-KGCAMPGYPDVYSSVLYARAWI-NSI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/231 (33%)
Tryp_SPc 27..243 CDD:238113 76/231 (33%)
AgaP_AGAP010243XP_554157.3 Tryp_SPc 47..269 CDD:238113 79/235 (34%)
Tryp_SPc 47..266 CDD:214473 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.