DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP008276

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_555189.1 Gene:AgaP_AGAP008276 / 3291691 VectorBaseID:AGAP008276 Length:272 Species:Anopheles gambiae


Alignment Length:260 Identity:88/260 - (33%)
Similarity:133/260 - (51%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQR-------IIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVT 64
            |..::|...||.|  :.|:|       |:||..:.|||||:|.::...|...|||||.....::|
Mosquito    14 LAAISLPISSAQQ--QQEERDDSATNMIVGGMKVDIEQVPYQAAILTLGQVHCGGSIIGPRWVLT 76

  Fly    65 AAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEF 129
            |.||.     :.|....|:|..||. ....|..:.|..|.:..|...|.|. |||:.:|:..|::
Mosquito    77 AYHCV-----DWLLPNFYEVAVGST-NPYEGQRILVQELFVPLETLSDPNF-DIALAKLAHTLQY 134

  Fly   130 TSKVQPIPL--AKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSL- 191
            :|.||.|||  :.::..|.:.|.:||:|.:. ...|.|:    |:...:.:.....|:...|.| 
Mosquito   135 SSTVQCIPLLTSDSSLIPDTPAYISGFGYTK-ERASDNI----LKAAQIKVLPWDYCQQAYPYLM 194

  Fly   192 ----LCAG-TYGRT-ACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAI 247
                |||| ..|:. :|.|||||||:||.:|.|||.:| :||....|   ::|||:|.:||:..:
Mosquito   195 REFMLCAGFKEGKVDSCQGDSGGPLIVNAKLAGVVFYG-EGCARPHFPGVYISVPWFSDWIIEVV 258

  Fly   248  247
            Mosquito   259  258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/235 (34%)
Tryp_SPc 27..243 CDD:238113 79/227 (35%)
AgaP_AGAP008276XP_555189.1 Tryp_SPc 39..257 CDD:238113 81/230 (35%)
Tryp_SPc 39..254 CDD:214473 79/227 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.