DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP011917

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_552323.2 Gene:AgaP_AGAP011917 / 3291454 VectorBaseID:AGAP011917 Length:246 Species:Anopheles gambiae


Alignment Length:258 Identity:76/258 - (29%)
Similarity:111/258 - (43%) Gaps:40/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQ-YFGDHVCGGSIYSENIIVTAAHCFFDE 72
            ||.....:||.    ..||:||........||.|||: ....|:|||::.|...::::|:|.   
Mosquito    10 LLIFPAFAAGP----NGRIVGGIDAVAGDAPWMVSLRNSINQHLCGGTLLSNRFVLSSANCL--- 67

  Fly    73 EGNRLDDQGYQVRAGSALTDSNGTLVDVAA-------LIIHEEYAFDLNINDIAIVRLSTPLEFT 130
             ..||        |.:.:..:....::.||       :|.|..:..:...:|:|:.:.:.....|
Mosquito    68 -SGRL--------ATATMAVAGSRFLNTAAIPYYGIQIITHPNFNVNTLEHDVALFQTALQFILT 123

  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLF-------- 187
            ..|||:||:.........|.|.|||.|.....:||.    ||.|.::..|...|..|        
Mosquito   124 QSVQPLPLSADVIGVGVRARVFGWGASQANGGNTNA----LQFLNVNTLSNDDCANFLGAEGWRI 184

  Fly   188 DPSLLCAGT-YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSA--FFVSVPYFREWILNAI 247
            .||.||..| .|:..|.||.||.||::...:||.|||.. |.:..  .||.:...|.||||.|
Mosquito   185 GPSSLCTLTREGQGICGGDEGGALVLDNYAIGVASWGIP-CATGRPDVFVRISAVRSWILNFI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/235 (29%)
Tryp_SPc 27..243 CDD:238113 66/234 (28%)
AgaP_AGAP011917XP_552323.2 Tryp_SPc 23..242 CDD:214473 67/235 (29%)
Tryp_SPc 24..242 CDD:238113 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.