DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and AgaP_AGAP005687

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_556332.3 Gene:AgaP_AGAP005687 / 3290023 VectorBaseID:AGAP005687 Length:297 Species:Anopheles gambiae


Alignment Length:284 Identity:78/284 - (27%)
Similarity:112/284 - (39%) Gaps:113/284 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY---FGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG 87
            |::.|:.....|.|:||:|..   .|..:||||:.:.|.|:|||||               |.|.
Mosquito    56 RVVNGQEALPGQFPYQVALLLNFPDGTALCGGSVLTRNFILTAAHC---------------VSAT 105

  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLN----------------------INDIAIVRLSTPLEFT 130
            |....|.|    :|.:..|...|.:|:                      .||:|::.|::|:.||
Mosquito   106 STTLVSGG----IAIMGAHNRTAMELSQQRIRFTSTGIRRHPEYDDTSLRNDVALILLNSPMTFT 166

  Fly   131 SKVQPIPL-AKT---------------------NPYPRSI-------------ALVSGWGVSYIL 160
            |:|:||.| |:|                     :|||.||             .:|| ||.:...
Mosquito   167 SRVKPISLPARTDTRQFEGFTGTVSGFGRSSDASPYPSSILRFTSNPIMSKAECIVS-WGFALAQ 230

  Fly   161 NDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLCAGTYGRTACHGDSGGPLVVNK---QLVGVVSW 222
            :.:..|.||.                           ||::|:|||||||.||.   ..:|.||:
Mosquito   231 SQNVCLKPTG---------------------------GRSSCNGDSGGPLTVNSGGVLQIGTVSF 268

  Fly   223 GRK-GCVSS--AFFVSVPYFREWI 243
            |.. ||.|.  :.:..|.||..||
Mosquito   269 GSSYGCASGWPSVYARVSYFLSWI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/282 (27%)
Tryp_SPc 27..243 CDD:238113 75/281 (27%)
AgaP_AGAP005687XP_556332.3 Tryp_SPc 56..292 CDD:214473 76/282 (27%)
Tryp_SPc 57..295 CDD:238113 77/283 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.