DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss34

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:268 Identity:87/268 - (32%)
Similarity:124/268 - (46%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LALDFLSAGQ--VNRWEQRIIGGEPIGIEQVPWQVSLQYFG------DHVCGGSIYSENIIVTAA 66
            |.|| |.:||  |.     |:||.|:...:.||||||:.:.      :|.||||:.....::|||
Mouse    22 LTLD-LGSGQGLVG-----IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAA 80

  Fly    67 HCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNIN---DIAIVRLSTPLE 128
            ||...:|   ::..|.:|:.|......|..|:.|..:|.|.:::..|:..   |||:::|.|.:.
Mouse    81 HCVRPKE---VEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVV 142

  Fly   129 FTSKVQPI--PLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSC------- 184
            .:..|.|:  |.|......:....|:||||  |.|......|.||:.:|:.|.....|       
Mouse   143 LSEHVYPVSLPAASLRISSKKTCWVAGWGV--IENYMPLPPPYHLREVAVPIVENNDCEQKYQTN 205

  Fly   185 -------RLFDPSLLCAGTYGRTACHGDSGGPLVVNKQL----VGVVSWGRKGCVSSAF---FVS 235
                   |:....:||||..||.:|..|||||||.....    ||||||| .||....|   :..
Mouse   206 SSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWG-IGCGLPDFPGVYTR 269

  Fly   236 VPYFREWI 243
            |..:..||
Mouse   270 VMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 78/248 (31%)
Tryp_SPc 27..243 CDD:238113 78/247 (32%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 80/249 (32%)
Tryp_SPc 35..277 CDD:214473 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.