DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG4653

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:254 Identity:80/254 - (31%)
Similarity:113/254 - (44%) Gaps:34/254 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            |||:.:..|...|.:|.        |..:...|..:||:..|.|||||::..|..|:|||||...
  Fly    13 LLLVVIVTLGVVQSSRL--------PAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSL 69

  Fly    72 EEGNR-LDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFD--LNINDIAIVRLSTPLEFTSKV 133
            ..|.: ...:.|.||.||....:.|.||.::.:|||..|:..  :..||:|::.|.|.:...:..
  Fly    70 GGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANT 134

  Fly   134 QPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR----LFDPSLLC- 193
            .||.||...|...|..:.||||.|.:....:::    ||.......|...|:    |....||| 
  Fly   135 NPIDLATERPAAGSQIIFSGWGSSQVDGSLSHV----LQVATRQSLSASDCQTELYLQQEDLLCL 195

  Fly   194 -------AGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSA--FFVSVPYFREWI 243
                   ||     .|.||:|.|...|.||||:.::...||.|..  .:|.|....|||
  Fly   196 SPVDEDFAG-----LCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 72/233 (31%)
Tryp_SPc 27..243 CDD:238113 72/232 (31%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 74/229 (32%)
Tryp_SPc 30..249 CDD:214473 72/227 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.