DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG9673

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:259 Identity:77/259 - (29%)
Similarity:116/259 - (44%) Gaps:38/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70
            |.|:|:.:....|       ||:|||.:...:.||..|::|...|||.|:|.|.|.|:|||||..
  Fly    15 FGLILSAEASPQG-------RILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTAAHCVS 72

  Fly    71 DEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQP 135
            ......:|.....||.|:....:.|::|:|.::|||..|...|  :||||:.|...|.|:.::|.
  Fly    73 SVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSYGNFL--HDIAILELDETLVFSDRIQD 135

  Fly   136 IPLAKT-------------NPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL- 186
            |.|..|             |..|   ..|:|||.   |:|.|..|...........:|:  |.. 
  Fly   136 IALPPTTDEETEDVDAELPNGTP---VYVAGWGE---LSDGTASYKQQKANYNTLSRSL--CEWE 192

  Fly   187 ----FDPSLLCAGTYGRTACHGDSGGPLV-VNKQLVGVVSWGRKGCVSSAFFVS--VPYFREWI 243
                ::..:..:...|...|.||:|..:: .:|.|.|:.|:....|.|....|:  |.|:..||
  Fly   193 AGYGYESVVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLTWI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/237 (30%)
Tryp_SPc 27..243 CDD:238113 70/236 (30%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 71/237 (30%)
Tryp_SPc 29..259 CDD:238113 72/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.