DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and sphe

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:261 Identity:76/261 - (29%)
Similarity:123/261 - (47%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFD 71
            |::|.|..|:|..:...:.||:|||........:..||:....|||||||.|:..|:|.||| ..
  Fly     6 LVILGLIGLTAVGMCHAQGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTTAHC-VH 69

  Fly    72 EEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPI 136
            .:|..:|......|.||....:.|.:|:|.::.:|.:| ::|| |::|::.||:.|.:|.::..|
  Fly    70 RDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY-YNLN-NNLAVITLSSELTYTDRITAI 132

  Fly   137 PLAKTN---PYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLLCAGTYG 198
            ||..:.   |...|..:|:|||.:   :|.||.|  .::.::|.:.         |...|...|.
  Fly   133 PLVASGEALPAEGSEVIVAGWGRT---SDGTNSY--KIRQISLKVA---------PEATCLDAYS 183

  Fly   199 --------------RTACHGDSGGPLVVNKQLVGVVSW--GRKGCVSSAFFVSVPYFREWILNAI 247
                          ...||||.||..:....|:|:.::  |..|......||.:..:.:||...|
  Fly   184 DHDEQSFCLAHELKEGTCHGDGGGGAIYGNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQEQI 248

  Fly   248 A 248
            |
  Fly   249 A 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/235 (29%)
Tryp_SPc 27..243 CDD:238113 66/234 (28%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 64/221 (29%)
Tryp_SPc 42..244 CDD:214473 62/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.