DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Ser7

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572582.1 Gene:Ser7 / 31917 FlyBaseID:FBgn0019929 Length:397 Species:Drosophila melanogaster


Alignment Length:275 Identity:80/275 - (29%)
Similarity:115/275 - (41%) Gaps:66/275 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQY-----FGDHVCGGSIYSENIIVTAAHCFFD----------EEGN 75
            |::||...|:.:.||...|:|     ..|:.||.|..::..::|||||...          .|.|
  Fly   131 RLVGGHNTGLFEFPWTTLLEYETVSGGKDYACGASFIAQRWLLTAAHCIHTMGRNLTAAILGEWN 195

  Fly    76 RLDDQGYQVRAGSALTDSNGT--------LVDVAALIIHEEYAFDLNI-NDIAIVRLSTPLEF-- 129
            |..|...:       .|.||.        .|.:..::.|.:|: :||. ||||::|||.|:.:  
  Fly   196 RDTDPDCE-------NDLNGVRECAPPHIRVTIDRILPHAQYS-ELNYRNDIALLRLSRPVNWLQ 252

  Fly   130 TSKVQPIPLAK-----TNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCR---- 185
            ...::|:.|..     .|....|.|.|||||.:.....|     ...|...|||:....|:    
  Fly   253 MQNLEPVCLPPQRGRYANQLAGSAADVSGWGKTESSGSS-----KIKQKAMLHIQPQDQCQEAFY 312

  Fly   186 ------LFDPSLLCAGTYGRTACHGDSGGPLVVNKQ---------LVGVVSWGRKGCVSSAF--- 232
                  |.|..:...|..|..:|.|||||||.|...         |.||||.|||.|.::.|   
  Fly   313 KDTKITLADSQMCAGGEIGVDSCSGDSGGPLTVEANTASGNRYVYLAGVVSIGRKHCGTALFSGI 377

  Fly   233 FVSVPYFREWILNAI 247
            :..|..:.:||.:.|
  Fly   378 YTRVSSYMDWIESTI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/269 (29%)
Tryp_SPc 27..243 CDD:238113 76/268 (28%)
Ser7NP_572582.1 CLIP 29..74 CDD:197829
Tryp_SPc 131..388 CDD:214473 77/269 (29%)
Tryp_SPc 133..391 CDD:238113 78/270 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.