DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG33159

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:241 Identity:75/241 - (31%)
Similarity:118/241 - (48%) Gaps:31/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70
            :|..|||...|:..    :.||:||:...|.:||:.|.|:..|..:||||:.|...:::||||.:
  Fly     9 WLCHLALVLPSSSS----KTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCVY 69

  Fly    71 DEEGNRLDDQGYQVRAGSALTDSNGTLV-DVAALIIHEEYA---FDLNINDIAIVRLSTPLEFT- 130
            ..:     .:|:.|.||::..|....:| :|........|:   ||:   |:|:::|...:..| 
  Fly    70 GSQ-----PEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFDM---DVALLQLQEVVVLTP 126

  Fly   131 SKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPT-HLQGLALHIKSIFSCRL-------F 187
            .||..|...:..|...:.|.:|||||:    ...|..|. .::...:.:.....|::       .
  Fly   127 GKVATISPCRNPPEGNAYARISGWGVT----RENNREPAEQVRTTMVRVLPGAECKISYSGYGQL 187

  Fly   188 DPSLLCAGTYG-RTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF 232
            ..|:|||...| |.:|.||||||||...|:.|:|||| .||...:|
  Fly   188 SDSMLCAAVRGLRDSCSGDSGGPLVYRGQVCGIVSWG-FGCARPSF 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/221 (32%)
Tryp_SPc 27..243 CDD:238113 69/220 (31%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 70/221 (32%)
Tryp_SPc 26..251 CDD:238113 69/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.