DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG31681

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:233 Identity:89/233 - (38%)
Similarity:122/233 - (52%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAGS 88
            |:||:||..|.||.||||||:|....|.|||.|||:..|:|||||.     :.:......|||||
  Fly    26 EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL-----SNVTVTDLSVRAGS 85

  Fly    89 ALTDSNGTLVDVAALIIHEEYAFDL-NINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVS 152
            :.....|.::.|...|.|.:|...| |..|||::.|..||.....|:.||||:..|...:|.|.|
  Fly    86 SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTS 150

  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRL------FDPSLLCAGTYGRTACHGDSGGPLV 211
            |||  |...:|:.|:|. |||:.:.|.:...|..      ....::||.......|.|||||||:
  Fly   151 GWG--YTRENSSFLWPI-LQGVHVAILNRTDCLKAYKHVNITIDMICADGQRWDTCQGDSGGPLI 212

  Fly   212 V-----NKQLVGVVSWGRKGC-VSSAFFVSVPYFREWI 243
            .     ::||:|:|||| .|| .:...:..:.:|..||
  Fly   213 ETTKGGHRQLIGMVSWG-DGCGTNPGVYEDIAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 86/229 (38%)
Tryp_SPc 27..243 CDD:238113 85/228 (37%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 86/229 (38%)
Tryp_SPc 29..250 CDD:238113 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443137
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.