DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG32834

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:279 Identity:86/279 - (30%)
Similarity:130/279 - (46%) Gaps:73/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLA---------LDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENI 61
            ||.|||         ||.         :.|||||..:.||..|:|..:...|..:|.|:|.:.:.
  Fly     6 FLFLLAALLRPVRGDLDA---------QSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDT 61

  Fly    62 IVTAAHCFFDEEGNRLDDQGY---QVRAGSALTDSNGT--LVDVAALIIHEEY---AFDLNINDI 118
            |:|||.|.          |.|   :||.|::..|.:||  |::|..:|.|.:|   .||   |::
  Fly    62 IITAASCV----------QSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFD---NNL 113

  Fly   119 AIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLY-----------PTHLQ 172
            |:::|..||:.:..:|||.:|:..|...|...|||||       ||:.:           |.:||
  Fly   114 ALLKLCDPLKTSEAIQPISIAEDEPDDGSWCTVSGWG-------STSWWGSWWDRCFGSLPDYLQ 171

  Fly   173 GLALHIKSIFSCR--------LFDPSL----LCAGTYGRTACHGDSGGPLVVNKQLVGVVSWGRK 225
            ...:.:.:...|.        |:|..:    ||... |...|..|:|.|||::.||||::|.|  
  Fly   172 MAWVSVYNREQCAADRGVWFGLWDNGISYLTLCTHN-GAGGCSYDTGAPLVIDGQLVGILSEG-- 233

  Fly   226 GCVSSA-FFVSVPYFREWI 243
            ||.:.. .:.:||:|..||
  Fly   234 GCTTKPDVYANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/248 (31%)
Tryp_SPc 27..243 CDD:238113 76/247 (31%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 77/248 (31%)
Tryp_SPc 27..255 CDD:238113 78/249 (31%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.