DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG32808

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:276 Identity:89/276 - (32%)
Similarity:136/276 - (49%) Gaps:42/276 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFIESFLLLLAL----DFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQ--YFGDHVCGGSIYSE 59
            |.:.::|..|||    .||.||.... :.:|:.|...|..:.|:.|||:  ..|.|.||.::.:.
  Fly     1 MAVMAWLARLALFYTATFLLAGASGE-DGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNP 64

  Fly    60 NIIVTAAHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLV-DVAALIIHEEY-AFDLNINDIAIVR 122
            ..::|||||.......:||     ::.||.:...|.:.| .|||:.:|..| ..|..:||||:::
  Fly    65 YWVLTAAHCVRGSSPEQLD-----LQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQ 124

  Fly   123 LSTPLEFTSKVQPIPLAKTNPYPRSI------ALVSGWGVSYILNDSTNLYPTHLQGLALHIKSI 181
            |:..:..:..|||:.|    |.||.:      |:::|||    ||.:..:...|||.:.|.:.|.
  Fly   125 LAQSVALSKFVQPVRL----PEPRQVTPGNASAVLAGWG----LNATGGVVQQHLQKVKLQVFSD 181

  Fly   182 FSCR------LFDPSLLCAG--TYGRTACHGDSGGPLVV--NKQLVGVVSWGRKGCVSSAF---F 233
            ..|.      |.| |.:|||  ..|:..|.|||||||::  :...||:|||..|.|....|   |
  Fly   182 TECSERHQTYLHD-SQICAGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVF 245

  Fly   234 VSVPYFREWILNAIAS 249
            ..|..:.:||:..:.|
  Fly   246 TEVSAYVDWIVETVNS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 77/239 (32%)
Tryp_SPc 27..243 CDD:238113 77/238 (32%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 77/239 (32%)
Tryp_SPc 30..258 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.