DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk14

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:261 Identity:80/261 - (30%)
Similarity:124/261 - (47%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLS-AGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDH--VCGGSIYSENIIVTAAH 67
            ||||:.|..|: |...::.:.:||||........||||:||....|  :|||.:.|:..::||||
Mouse     2 FLLLIILQALAVAIAQSQGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSDQWVITAAH 66

  Fly    68 C----FFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLE 128
            |    .....|.      :.:|...|...    :|.||..:.|.:|....:.||:.:::|...:.
Mouse    67 CARPILHVALGK------HNIRRWEATQQ----VVRVARQVPHPQYQPQAHDNDLMLLKLQKKVR 121

  Fly   129 FTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDPSLL- 192
            ....|:.|.:|.:...|.:...|||||.   :......|||.||.:.::|.|..:|....|.:: 
Mouse   122 LGRAVKTISVASSCASPGTPCRVSGWGT---IASPIARYPTALQCVNVNIMSEQACHRAYPGIIT 183

  Fly   193 ----CAGT--YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIA 248
                |||.  .|:.:|.||||||||...||.|:||||.:.|....:   :.::..:..||...:.
Mouse   184 SGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWIQRTMQ 248

  Fly   249 S 249
            |
Mouse   249 S 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 70/232 (30%)
Tryp_SPc 27..243 CDD:238113 70/231 (30%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 72/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.