DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk15

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:262 Identity:81/262 - (30%)
Similarity:119/262 - (45%) Gaps:40/262 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFF 70
            :|||..:..:||.|..   .:::.||.......||||:|...|...||..:.|...::|||||  
Mouse     2 WLLLAFVLLVSAAQDG---DKVLEGEECVPHSQPWQVALFERGRFNCGAFLISPRWVLTAAHC-- 61

  Fly    71 DEEGNRLDDQGYQVRAGS---ALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSK 132
                   ..:..:||.|.   ...|....|..|:.:|.|..|....:.:||.::||..|...|:.
Mouse    62 -------QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRLFKPARLTAY 119

  Fly   133 VQPIPLAKTNPYPRSIALVSGWGVSYILND----STNLYPTHLQ-GLALHIKSI-----FSC--- 184
            |:|:.|.:..|......:|||||   :|:|    :|....:|:: ...||..:|     .||   
Mouse   120 VRPVALPRRCPLIGEDCVVSGWG---LLSDNNPGATGSQKSHVRLPDTLHCANISIISEASCNKD 181

  Fly   185 ---RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSVPYFRE 241
               |:. |:::|||..  |..:|.||||||||....|.|:||||...|   .....:..|..:.|
Mouse   182 YPGRVL-PTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVYTKVCSYLE 245

  Fly   242 WI 243
            ||
Mouse   246 WI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 73/240 (30%)
Tryp_SPc 27..243 CDD:238113 73/239 (31%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 73/236 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.