DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG6041

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:280 Identity:91/280 - (32%)
Similarity:138/280 - (49%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESFLLLLAL-DFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQ--------YFGDHVCGGSIYS 58
            |..||..||. :.||:....:.|.:|:||....||||.:|||::        |...|:|||.:.|
  Fly    10 IALFLGALASGESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCGGVVIS 74

  Fly    59 ENIIVTAAHCFF--DEEGNRLDDQGYQVRAGSALTDS-NGTLV-DVAALIIHEEYAFDLNINDIA 119
            :.::.|||||.:  |::..|...:...|...:.||.| :.||: .:..||.||.|..|...||||
  Fly    75 QRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDALTNDIA 139

  Fly   120 IVRLS----------TPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGL 174
            ::.::          |.|...|:     |..||    :..|:||||   :|..:.......||..
  Fly   140 LMFINGYIPWNWPTVTALALNSQ-----LVATN----TDCLISGWG---LLQQNGTFSSNTLQAA 192

  Fly   175 ALHIKSIFSCRL----FDPSLLCAG--TYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF- 232
            .:.|.|..:||:    ...|.:|||  :.|..||.||||||:..|..|.|:||:| .||.:..: 
  Fly   193 TVPIVSYTTCRISYNSIPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYG-AGCAAPGYP 256

  Fly   233 --FVSVPYFREWILNAIASI 250
              :.:|.|:.:||:...:|:
  Fly   257 GVYTNVSYYYDWIVQKNSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 80/247 (32%)
Tryp_SPc 27..243 CDD:238113 80/246 (33%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/247 (32%)
Tryp_SPc 35..272 CDD:238113 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.