DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prtn3

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:271 Identity:68/271 - (25%)
Similarity:109/271 - (40%) Gaps:57/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYF---GDHVCGGSIYSENIIVTAAHC 68
            |.|..:.|..|.|.:    :|:||........|:..|||..   |.|.|||::.....::|||||
  Rat   182 LRLAGVRFHGAVQAS----KIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFVLTAAHC 242

  Fly    69 FFDEEGNRLDDQGYQ-----VRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLE 128
                    |.|..:|     :.|...|:............:....|..:..:||:.:::|:.|..
  Rat   243 --------LQDISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPAS 299

  Fly   129 FTSKVQPIPLAKTNPYPRSIA-----LVSGWG-------VSYILNDSTNLYPTHLQGLALHIKSI 181
            ...:|....|.:.:   :|::     |..|||       ...:|::             |::..:
  Rat   300 LGKQVAVASLPQQD---QSLSQGTQCLAMGWGRLGTRAPTPRVLHE-------------LNVTVV 348

  Fly   182 -FSCRLFDPSLLCAGTYGRTA--CHGDSGGPLVVNKQLVGVVSWGRKGCVS---SAFFVSVPYFR 240
             |.||..:   :|.....|.|  |.|||||||:.|..|.||.|:..:.|.|   ..||..|..:.
  Rat   349 TFLCREHN---VCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYV 410

  Fly   241 EWILNAIASIQ 251
            .||.:.:.|.:
  Rat   411 NWIHSVLRSAE 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 60/242 (25%)
Tryp_SPc 27..243 CDD:238113 60/241 (25%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.