DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and LOC312273

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:236 Identity:78/236 - (33%)
Similarity:116/236 - (49%) Gaps:24/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQG-YQVRAG 87
            :.||:||.......||:||||. .|.|:||||:.::..:::||||:..:...||.:.. |::...
  Rat    22 DDRIVGGYTCQEHSVPYQVSLN-AGSHICGGSLITDQWVLSAAHCYHPQLQVRLGEHNIYEIEGA 85

  Fly    88 SALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVS 152
            .       ..:|.|.:|:|.:|......|||.:::|.:|....|||..|||.:..|...:..|||
  Rat    86 E-------QFIDAAKMILHPDYDKWTVDNDIMLIKLKSPATLNSKVSTIPLPQYCPTAGTECLVS 143

  Fly   153 GWGVSYILNDSTNLYPTHLQGLALHIKSIFSC-----RLFDPSLLCAGTY--GRTACHGDSGGPL 210
            ||||.....:|    |:.||.|...:.|...|     |....::.|.|..  |:.:|..|||||:
  Rat   144 GWGVLKFGFES----PSVLQCLDAPVLSDSVCHKAYPRQITNNMFCLGFLEGGKDSCQYDSGGPV 204

  Fly   211 VVNKQLVGVVSWGRKGCV---SSAFFVSVPYFREWILNAIA 248
            |.|.::.|:|||| .||.   ....:..|..:..||...||
  Rat   205 VCNGEVQGIVSWG-DGCALEGKPGVYTKVCNYLNWIHQTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 74/227 (33%)
Tryp_SPc 27..243 CDD:238113 73/226 (32%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 75/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.