DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG14780

DIOPT Version :10

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:61 Identity:12/61 - (19%)
Similarity:26/61 - (42%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VPTVCVSCRGFRLQK--FKPTKTKSIPQENKSKPSKQSTVGKTVTVRLPRSPQSEKVFDTY 66
            :||:....:||:|.:  .|.:...::.|..|:...|...:..:::..|......|...|.:
  Fly   274 LPTIQQCNKGFKLSEDLKKRSSAPALAQFFKANVQKDKILCTSLSTLLTDIADYESPLDAF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 27..243 CDD:238113 6/40 (15%)
CG14780NP_569920.2 Tryp_SPc 33..271 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.