DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and CG11664

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:265 Identity:70/265 - (26%)
Similarity:121/265 - (45%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IESF-LLLLALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFG-DHVCGGSIYSENIIVTA 65
            :||. |:|||:       ..||...:..|.|  ::|..:...:|.:| ..:..||::|...::|.
  Fly     5 VESLQLILLAI-------AVRWGDALHRGIP--VQQQNYGYVMQIYGPQFLAAGSLFSARYVLTV 60

  Fly    66 AHCFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFT 130
            ||||   :.|...:: ..||||............||.|:.|.:::.....||||::|:...:..:
  Fly    61 AHCF---KKNTKPEE-LSVRAGYRWIAWEFRGKQVAGLLRHPKFSPLTLRNDIAVLRVKAAISHS 121

  Fly   131 SKVQPI-----PLAKTNPY--PRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIFSCRLFD 188
            ..:..|     ||...|.:  |:.:|   ||.:.:|...        |:.:::.::...:||.:.
  Fly   122 HMINYIGLCSRPLTPLNMFAPPQELA---GWNLMHIAQP--------LKSMSVQVEPEKNCRQWF 175

  Fly   189 PSL----LCA-GTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFFVSVPYFREWILN 245
            |.:    :|| .|.|...|:||||.||:...::.|:....|| |...   |.|..|.|.|.:|..
  Fly   176 PQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRK-CGDKRYPALFTDVHYHRAFIAQ 239

  Fly   246 AIASI 250
            |:.::
  Fly   240 AVLTL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 60/232 (26%)
Tryp_SPc 27..243 CDD:238113 60/231 (26%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 58/216 (27%)
Tryp_SPc 38..237 CDD:214473 57/214 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.