DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk14

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:265 Identity:77/265 - (29%)
Similarity:121/265 - (45%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLLALDFLSAGQV-NRWEQRIIGGEPIGIEQVPWQVSLQYFGDH--VCGGSIYSENIIVTAAHC 68
            |||..|..|:...| ::.:.:|:||........||||:||.....  :|||.:.|:..::|||||
  Rat    63 LLLTILQALAVAIVQSQGDDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLLSDQWVITAAHC 127

  Fly    69 -------FFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTP 126
                   ...:...|..:...||             :.|...:.|.:|....:.||:.:::|...
  Rat   128 ARPLLHVALGKHNLRRWEATQQV-------------LRVVRQVPHPQYRPQAHDNDLMLLKLQRK 179

  Fly   127 LEFTSKVQPIPLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQGLALHIKSIFSCRLFDP 189
            :.....|:.||:|::...|.:...|||||  .|.|:.     |||.||.:.::|.....|....|
  Rat   180 VRLGRAVRTIPVARSCASPGTPCRVSGWGTTASPIVR-----YPTALQCVNVNIMPEQVCHRAYP 239

  Fly   190 -----SLLCAGT--YGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWIL 244
                 .::|||.  .|:.:|.||||||||...||.|:||||.:.|....:   :.::..:..||.
  Rat   240 GTITSGMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYTNLCNYHSWIQ 304

  Fly   245 NAIAS 249
            ..:.|
  Rat   305 RTMQS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 68/237 (29%)
Tryp_SPc 27..243 CDD:238113 68/236 (29%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 70/239 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.