DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss22

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:259 Identity:80/259 - (30%)
Similarity:122/259 - (47%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQ 83
            |:|    |::|||.....|.||.||:...|.|.|.||:.:...:|:|||||   ..|......|.
  Rat    46 QLN----RVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRWVVSAAHCF---SSNMDKPSPYS 103

  Fly    84 VRAGSALTDSNG---TLVDVAALIIHEEYAFDLNIN-DIAIVRLSTPLEFTSKVQPIPLAKTNPY 144
            |..|:....:.|   ..|.:|:::.|..|:.....: |||:|||..|::|:.::.||.|..::.:
  Rat   104 VLLGAWKLGNPGPRSQKVGIASVLPHPRYSRKEGTHADIALVRLERPIQFSERILPICLPDSSVH 168

  Fly   145 --PRSIALVSGWGVSYILNDSTNL-YPTHLQGLALHI------KSIF----SCRLFDPSLLCAGT 196
              |.:...::|||   .:.|...| .|..||.|.:.|      ||::    ........:||||.
  Rat   169 LPPNTNCWIAGWG---SIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQEAITEDMLCAGY 230

  Fly   197 Y--GRTACHGDSGGPLVVNKQ----LVGVVSWGRKGCVS---SAFFVSVPYFREWILNAIASIQ 251
            .  .|.||.|||||||:....    |.|::||| :||..   ...:.|:...|.|:...:..:|
  Rat   231 LEGKRDACLGDSGGPLMCQVDDHWLLTGIISWG-EGCAERNRPGVYTSLLAHRPWVQRIVQGVQ 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 76/242 (31%)
Tryp_SPc 27..243 CDD:238113 75/241 (31%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 76/242 (31%)
Tryp_SPc 50..288 CDD:238113 76/244 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.