DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Prss32

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001100453.1 Gene:Prss32 / 302970 RGDID:1311905 Length:334 Species:Rattus norvegicus


Alignment Length:256 Identity:88/256 - (34%)
Similarity:132/256 - (51%) Gaps:40/256 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCFFDEEGNRLDDQGYQVRAG--S 88
            ||:.|:...:.|.|||||::..|.||||||:.||:.::||||||..::    ....|.|..|  |
  Rat    53 RIVSGQNAQLGQWPWQVSVREDGVHVCGGSLISEDWVLTAAHCFNQDQ----HLSAYTVLLGTIS 113

  Fly    89 ALTDSN--GTLVDVAALIIHEEY-AFDLNINDIAIVRLSTPLEFTSKVQPIPLAKT-NPY-PRSI 148
            :..:.|  ..|..||..|.:..| |.:.:..|||:::|::|:.|...:.|:.|.|. :|. |.::
  Rat   114 SYPEDNEPRELRAVAQYIKYPSYSAEEHSSGDIALLQLASPISFNDYMLPVCLPKPGDPLDPGTM 178

  Fly   149 ALVSGWGVSYILNDSTNL---YPTHLQGLALHIKSIFSCRLF-----DPS--------LLCAGTY 197
            ..|:|||     |.:||.   .|..||.|.:.:....:|..:     .||        :||||..
  Rat   179 CWVTGWG-----NIATNQPLPPPFTLQELQVPLIDAKTCNTYYQENSVPSTEQVILEDMLCAGFV 238

  Fly   198 --GRTACHGDSGGPLV--VNKQLV--GVVSWGRKGCVSS--AFFVSVPYFREWILNAIASI 250
              .:.||:||||||||  ||...:  ||||||....:|:  ..:.:|..:..||.|.:.:|
  Rat   239 EGKKDACNGDSGGPLVCDVNDVWIQAGVVSWGSDCALSNRPGVYTNVSVYISWIQNTMWNI 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 84/247 (34%)
Tryp_SPc 27..243 CDD:238113 83/246 (34%)
Prss32NP_001100453.1 Tryp_SPc 53..292 CDD:214473 84/247 (34%)
Tryp_SPc 54..295 CDD:238113 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.