DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and HABP2

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_004123.1 Gene:HABP2 / 3026 HGNCID:4798 Length:560 Species:Homo sapiens


Alignment Length:284 Identity:70/284 - (24%)
Similarity:110/284 - (38%) Gaps:73/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FLSAGQ---VNRWEQRIIGGEPIGIEQVPWQVSLQYF--------GDHVCGGSIYSENIIVTAAH 67
            |.|.|:   ..|..:||.||......:.|||.|||..        ..|.|||::.....::||||
Human   298 FDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTAAH 362

  Fly    68 CF-------------FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIA 119
            |.             .|.:.....:|.::              |:......|.....::..||||
Human   363 CTDIKTRHLKVVLGDQDLKKEEFHEQSFR--------------VEKIFKYSHYNERDEIPHNDIA 413

  Fly   120 IVRLSTPLEFTSKVQPIP--LAKTNPYPRSIAL------------VSGWGVSYILNDSTNLYPTH 170
            ::          |::|:.  .|..:.|.:::.|            :|||||:.....|..|....
Human   414 LL----------KLKPVDGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAK 468

  Fly   171 LQGLA---LHIKSIFSCRLFDPSLLCAGTY---GRTACHGDSGGPLVVNKQ----LVGVVSWGRK 225
            ::.:|   .:.:.::. .:.|.|::|||..   |:..|.|||||||...|.    :.|:||||.:
Human   469 VKLIANTLCNSRQLYD-HMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLE 532

  Fly   226 GCVSSAFFVSVPYFREWILNAIAS 249
            .......:..|..|..||...|.|
Human   533 CGKRPGVYTQVTKFLNWIKATIKS 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 62/261 (24%)
Tryp_SPc 27..243 CDD:238113 61/260 (23%)
HABP2NP_004123.1 EGF 77..106 CDD:306513
KR 191..277 CDD:238056
Tryp_SPc 314..553 CDD:238113 63/263 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.