DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk1c3

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:267 Identity:80/267 - (29%)
Similarity:117/267 - (43%) Gaps:51/267 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNR---WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAH 67
            ||:|...  ||.||::.   .:.|::||........||||::  ..:.:|||.:...:.::||||
  Rat     3 FLILFLA--LSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAV--INEDLCGGVLIDPSWVITAAH 63

  Fly    68 CFFDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALII-----HEEYAFDL----------NIND 117
            |:.|         .|.|..|     .|....||...::     |.:|...|          ..||
  Rat    64 CYSD---------NYHVLLG-----QNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSND 114

  Fly   118 IAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHIKSIF 182
            :.::.||.|.:.|..|:.|.|....|...|..||||||.:   |.|...:|..||.:.:|:.|..
  Rat   115 LMLLHLSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGST---NPSEWEFPDDLQCVNIHLLSNE 176

  Fly   183 SC------RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGC---VSSAFFVSV 236
            .|      ::.| .:||||..  |:..|.|||||||:.:..|.|:.|||...|   .....:..:
  Rat   177 KCIKAYKEKVTD-LMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKL 240

  Fly   237 PYFREWI 243
            ..|..||
  Rat   241 IKFTSWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 71/242 (29%)
Tryp_SPc 27..243 CDD:238113 70/241 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 71/242 (29%)
Tryp_SPc 25..250 CDD:238113 72/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.