DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17234 and Klk1c12

DIOPT Version :9

Sequence 1:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:270 Identity:76/270 - (28%)
Similarity:116/270 - (42%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FLLLLALDFLSAGQVNR---WEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAH 67
            :|.:|.| |||.|:::.   .:.|::||........||||::  ...::|||.:...:.::||||
  Rat     2 WLQILFL-FLSVGRIDAAPPGQSRVVGGYKCEKNSQPWQVAV--INRYLCGGVLIDPSWVITAAH 63

  Fly    68 CFFDEEGNRLDDQGYQVRAGSALTDSNGTLVD--------VAALIIHEEY-----------AFDL 113
            |:.....|      |.|..|     .|....|        |.....|.:|           ..|.
  Rat    64 CYSHALSN------YHVLLG-----RNNLFKDEPFAQYRFVNQSFPHPDYNPFFMKNHTLFPGDD 117

  Fly   114 NINDIAIVRLSTPLEFTSKVQPIPLAKTNPYPRSIALVSGWGVSYILNDSTNLYPTHLQGLALHI 178
            :.||:.::.||.|.:.|..|:.|.|....|...|..|.|||..:..|...   :|..||.:.::|
  Rat   118 HSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWSSTKPLEWE---FPDDLQCVNINI 179

  Fly   179 KSIFSC-----RLFDPSLLCAGTY--GRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSS---AFF 233
            .|...|     ::....:||||..  |:..|:|||||||:.:..|.|:.||....|..:   |.:
  Rat   180 LSNEKCIKAHTQMVTDVMLCAGELEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIY 244

  Fly   234 VSVPYFREWI 243
            ..:..|..||
  Rat   245 TKLIKFTSWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 67/245 (27%)
Tryp_SPc 27..243 CDD:238113 66/244 (27%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.